General Information

  • ID:  hor006465
  • Uniprot ID:  Q7M3C4
  • Protein name:  Relaxin B chain
  • Gene name:  NA
  • Organism:  Phocoenoides dalli dalli (Dall's porpoise)
  • Family:  Insulin family
  • Source:  animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:   Phocoenoides dalli (species), Phocoenoides (genus), Phocoenidae (family), Odontoceti (parvorder), Cetacea (infraorder), Whippomorpha (suborder), Artiodactyla (order), Laurasiatheria (superorder), Boreoeutheria , Eutheria , Theria , Mammalia (class), Amniota , Tetrapoda , Dipnotetrapodomorpha , Sarcopterygii (superclass), Euteleostomi , Teleostomi , Gnathostomata , Vertebrata , Craniata (subphylum), Chordata (phylum), Deuterostomia , Bilateria , Eumetazoa , Metazoa (kingdom), Opisthokonta , Eukaryota (superkingdom),cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0007165 signal transduction
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  QRTNDFIKACGRELVRVWVEICGSVSWGRTA
  • Length:  31(1-31)
  • Propeptide:  QRTNDFIKACGRELVRVWVEICGSVSWGRTA
  • Signal peptide:  NA
  • Modification:  T1 Pyrrolidone carboxylic acid
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Relaxin is an ovarian hormone that acts with estrogen to produce dilatation of the birth canal in many mammals.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-Q7M3C4-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    AF-Q7M3C4-F1.pdbhor006465_AF2.pdbhor006465_ESM.pdb

Physical Information

Mass: 407335 Formula: C154H246N48O44S2
Absent amino acids: HMPY Common amino acids: RV
pI: 8.83 Basic residues: 5
Polar residues: 10 Hydrophobic residues: 12
Hydrophobicity: -14.19 Boman Index: -6413
Half-Life: 0.8 hour Half-Life Yeast: 10 min
Half-Life E.Coli: >10 hour Aliphatic Index 81.61
Instability Index: 1396.13 Extinction Coefficient cystines: 11125
Absorbance 280nm: 370.83

Literature

  • PubMed ID:  NA
  • Title:  NA